
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P01552
Gene Names: entB
Organism: Staphylococcus aureus
AA Sequence: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Expression Region: 28-266aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 55.4 kDa
Alternative Name(s): SEB
Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Reference: Nucleotide sequence of the enterotoxin B gene from Staphylococcus aureus.Jones C.L., Khan S.A.J. Bacteriol. 166:29-33(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Staphylococcus aureus Enterotoxin type B(entB)
- Regular price
- €917,95 EUR
- Sale price
- €917,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type E(entE)
- Regular price
- €504,95 EUR
- Sale price
- €504,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type E(entE)
- Regular price
- €1.007,95 EUR
- Sale price
- €1.007,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type C-1(entC1)
- Regular price
- €917,95 EUR
- Sale price
- €917,95 EUR
- Regular price
-
- Unit price
- per
Sold out