Skip to product information
1 of 1

Gene Bio Systems

Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6)

Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6)

SKU:CSB-CF321404SJZ

Regular price €1.243,95 EUR
Regular price Sale price €1.243,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)

Uniprot NO.:P15897

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDMKFWTTKEYKKIKRDFIIRNFAFGFCYFLFLISFIMCIVCFIISINFEVEIILVILFP FLLLILSVWNLFDLIMEHISEIKRFKVTVLKKQIEELEGKMLRGLRVGVDKIE

Protein Names:Recommended name: Uncharacterized protein ORF6 Alternative name(s): Gene 6 protein

Gene Names:ORF Names:ORF6

Expression Region:1-113

Sequence Info:full length protein

View full details