Skip to product information
1 of 1

Gene Bio Systems

Recombinant Spinacia oleracea Cytochrome b6-f complex iron-sulfur subunit, chloroplastic(petC)

Recombinant Spinacia oleracea Cytochrome b6-f complex iron-sulfur subunit, chloroplastic(petC)

SKU:CSB-CF362568FKI

Regular price €1.463,95 EUR
Regular price Sale price €1.463,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Spinacia oleracea (Spinach)

Uniprot NO.:P08980

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATSIPADNVPDMQKRETLNLLLLGALSLPTGYMLLPYASFFVPPGGGAGTGGTIAKDALG NDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLATFGINAVCTHLGCVVPFNAAE NKFICPCHGSQYNNQGRVVRGPAPLSLALAHCDVDDGKVVFVPWTETDFRTGEAPWWSA

Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit, chloroplastic EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein Rieske iron-sulfur protein Short name= ISP Shor

Gene Names:Name:petC

Expression Region:52-230

Sequence Info:full length protein

View full details