Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sphingopyxis alaskensis UPF0314 protein Sala_3154(Sala_3154)

Recombinant Sphingopyxis alaskensis UPF0314 protein Sala_3154(Sala_3154)

SKU:CSB-CF625270SAAS

Regular price €1.471,95 EUR
Regular price Sale price €1.471,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)

Uniprot NO.:Q1GNB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGGISRTGWLVAAALVALLAAILIFMGRPPICPCGTVSLWHGTVQSNQNSQQISDWYSF SHIIHGFIFYGVLRWIMPERALWVPLAIAIGTEGAWEILENSPLIIDRYREVTMAFGYSG DSVLNSVSDTLFMVAGFLAAGRMRWWVTAALAIAFELFTLWTIRDNLTLNVLMLVSPVEA IKDWQAGG

Protein Names:Recommended name: UPF0314 protein Sala_3154

Gene Names:Ordered Locus Names:Sala_3154

Expression Region:1-188

Sequence Info:full length protein

View full details