Gene Bio Systems
Recombinant Spermidine export protein MdtJ(mdtJ)
Recombinant Spermidine export protein MdtJ(mdtJ)
SKU:CSB-CF304793EOD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O157:H7
Uniprot NO.:P69213
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Protein Names:Recommended name: Spermidine export protein MdtJ
Gene Names:Name:mdtJ Ordered Locus Names:Z2594, ECs2306
Expression Region:1-121
Sequence Info:full length protein
