Skip to product information
1 of 1

Gene Bio Systems

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 13, chloroplastic(CAB13)

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 13, chloroplastic(CAB13)

SKU:CSB-CF340885SZY

Regular price €1.506,95 EUR
Regular price Sale price €1.506,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Uniprot NO.:P27489

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRW AMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGF QVVLMGLVEGFRINGLPGVGEGNDLYPGGQYFDPLGLADDPTTFAELKVKEIKNGRLAMF SMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGA

Protein Names:Recommended name: Chlorophyll a-b binding protein 13, chloroplastic Alternative name(s): LHCII type III CAB-13

Gene Names:Name:CAB13 Synonyms:LHBC1

Expression Region:43-265

Sequence Info:full length protein

View full details