Gene Bio Systems
Recombinant Simulium vittatum NADH-ubiquinone oxidoreductase chain 4(ND4)
Recombinant Simulium vittatum NADH-ubiquinone oxidoreductase chain 4(ND4)
SKU:CSB-CF015079SHX-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Simulium vittatum (Striped black fly)
Uniprot NO.:P50660
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SVVAHMGIVLSGLMTLTMWGISGSYTLMIAHGLCSSGLFCLANISYERMGSRSLLINKGL LNFMPSLSLWWFLLCSSNM
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4
Gene Names:Name:ND4
Expression Region:1-79
Sequence Info:full length protein
