Gene Bio Systems
Recombinant Silicibacter pomeroyi Large-conductance mechanosensitive channel(mscL)
Recombinant Silicibacter pomeroyi Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF711596SAAC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Uniprot NO.:Q5LMR7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLQEFKTFIAKGNVMDMAVGIIIGAAFTAIVKSLVDDLINPIIGLFTGGVDFTNNFVVLG GDGTAYASLAAAREAGASVFAYGAFFMAVFNFLIIAWVVFMLVKAVNRAKEAAAKEEAAA EPAAPAGPSELDVLLEIRDSLKR
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:SPO3495
Expression Region:1-143
Sequence Info:full length protein
