Gene Bio Systems
Recombinant Shewanella sp. UPF0114 protein Shewmr4_0646(Shewmr4_0646)
Recombinant Shewanella sp. UPF0114 protein Shewmr4_0646(Shewmr4_0646)
SKU:CSB-CF606413SAAN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella sp. (strain MR-4)
Uniprot NO.:Q0HMJ1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHILPIIFEMTEVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMDVKNIDNDKIMWYLLIHITFVVSAFAMGYLDKMTRK
Protein Names:Recommended name: UPF0114 protein Shewmr4_0646
Gene Names:Ordered Locus Names:Shewmr4_0646
Expression Region:1-162
Sequence Info:full length protein
