Gene Bio Systems
Recombinant Shewanella oneidensis UPF0208 membrane protein SO_2914(SO_2914)
Recombinant Shewanella oneidensis UPF0208 membrane protein SO_2914(SO_2914)
SKU:CSB-CF813688SGA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella oneidensis (strain MR-1)
Uniprot NO.:Q8ED56
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSINILKTLGDGRRYMKTWPMVRQLGLYFPEYRVVRATQLAILVMPVLAVLASVSQLYTY GWAFLPQALTIALFFISLPLQGLLWLGWRARHPLPLSLFDWSNQLSAKLTAMGIHCQSLG AKACYLDMALILKIAFERLDASYWEEL
Protein Names:Recommended name: UPF0208 membrane protein SO_2914
Gene Names:Ordered Locus Names:SO_2914
Expression Region:1-147
Sequence Info:full length protein
