Skip to product information
1 of 1

Gene Bio Systems

Recombinant Serpentine receptor class beta-10(srb-10)

Recombinant Serpentine receptor class beta-10(srb-10)

SKU:CSB-CF342411CXY

Regular price €1.468,95 EUR
Regular price Sale price €1.468,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:P46501

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDDSDACTKAANLALHPLFRASNIYQMIISYLSILPLFYFLAFKFSKSSFHGNLKVIFY CYFITLILFSTVYGVTATIQFIRPLTAIRSCDLIVPSLHHKIGNLPICFLVTLSAYFPFT ITVERYYAMNKSEKYEKMPIILGPLFVLFIVIVNFGVIFQIYKNETFSHGDVAFSLYSHF MWYYF

Protein Names:Recommended name: Serpentine receptor class beta-10 Short name= Protein srb-10

Gene Names:Name:srb-10 ORF Names:F23F12.11/F23F12.5

Expression Region:1-185

Sequence Info:full length protein

View full details