Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sec-independent protein translocase protein TatA(tatA)

Recombinant Sec-independent protein translocase protein TatA(tatA)

SKU:CSB-CF300205EGX

Regular price €1.367,95 EUR
Regular price Sale price €1.367,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O6

Uniprot NO.:P69429

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV

Protein Names:Recommended name: Sec-independent protein translocase protein TatA

Gene Names:Name:tatA Synonyms:mttA1 Ordered Locus Names:c4785

Expression Region:1-89

Sequence Info:full length protein

View full details