Gene Bio Systems
Recombinant Schizosaccharomyces pombe Uncharacterized protein C2C4.05 (SPAC2C4.05)
Recombinant Schizosaccharomyces pombe Uncharacterized protein C2C4.05 (SPAC2C4.05)
SKU:CSB-CF517615SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O14038
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSAWIYFTSLMLTCANIMLQMYFTVMYSDLKDDFINPIDLSRKLNWYVLPEMGFQAFSA LLLLLSGAWITFLLNVPMLAWNAKMIMSNTHMHDSTTIFKDVSSRQKRSFFKLACFAVFF FVYLFLFVSRLVDE
Protein Names:Recommended name: Uncharacterized protein C2C4.05
Gene Names:ORF Names:SPAC2C4.05
Expression Region:1-134
Sequence Info:full length protein
