Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Uncharacterized protein C11D3.19 (SPAC11D3.19)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C11D3.19 (SPAC11D3.19)

SKU:CSB-CF517266SXV

Regular price €1.356,95 EUR
Regular price Sale price €1.356,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVPYTETSICLTNVPCGYMNVSGCFKGADALTILHECDEANVYTATFWSTSSGTRRNSAV ICTLIANLMAFFMLLTM

Protein Names:Recommended name: Uncharacterized protein C11D3.19

Gene Names:ORF Names:SPAC11D3.19

Expression Region:1-77

Sequence Info:full length protein

View full details