
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q9USM7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSWLFTRNKEEEPTSKIDSSELQVPTEATASDILSGSEFDPAKLHPLADLDKPLDYLLIE EDALSTLPGDSMAIPSRGWQDDLCYGTGTSYLSGLAIGGLWGLNEGMKKTKDITSTRLRL NGILNGVTRRGPFVGNSLGVLALVYNGINSLIGYKRQKHGWENSVAAGALTGALYKSTRG LRAMAISSSLVATAAGIWTLAKRSFTKRLN
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim23
Gene Names:Name:tim23 ORF Names:SPCC16A11.09c
Expression Region:1-210
Sequence Info:full length protein
You may also like
-
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim22(tim22)
- Regular price
- €1.073,95 EUR
- Sale price
- €1.073,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim21(tim21)
- Regular price
- €1.092,95 EUR
- Sale price
- €1.092,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim17(tim17)
- Regular price
- €1.065,95 EUR
- Sale price
- €1.065,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim54(tim54)
- Regular price
- €1.201,95 EUR
- Sale price
- €1.201,95 EUR
- Regular price
-
- Unit price
- per
Sold out