Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 84 protein(mug84)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 84 protein(mug84)

SKU:CSB-CF517592SXV

Regular price €1.479,95 EUR
Regular price Sale price €1.479,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O13904

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLTHHSTFIKGIEGSAEGEIEDVRQTTVFDPPFYGHPMLVPPSPSLTTMFRTRSTTPDE EGTAIAEIDQQDWDIMVKVPTYEYYGFVMYLVSMLGFGVYIVWALTPAPVLKFFEIHYYL SRWWALAIPTWLFVLVIYIHVVLNAYNTEVLTKPFSSLECIVDQYALVGEEDGAAHGRVV DLRLCDVNKQQLEET

Protein Names:Recommended name: Meiotically up-regulated gene 84 protein

Gene Names:Name:mug84 ORF Names:SPAC22A12.13

Expression Region:1-195

Sequence Info:full length protein

View full details