Recombinant Schizosaccharomyces pombe Glucan endo-1,3-alpha-glucosidase agn1(agn1)

Recombinant Schizosaccharomyces pombe Glucan endo-1,3-alpha-glucosidase agn1(agn1)

CSB-EP522580SXVb1
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: agn1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: SchizosaccharoMyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Delivery time: 3-7 business days

Uniprot ID: O13716

AA Sequence: DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-424aa

Protein length: Full Length of Mature Protein

MW: 51.8 kDa

Alternative Name(s): Endo-1,3-alpha-glucanase agn1

Relevance: Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides.

Reference: "A functional genome-wide genetic screening identifies new pathways controlling the G1/S transcriptional wave." Gaspa L., Gonzalez-Medina A., Hidalgo E., Ayte J. Cell Cycle 15:720-729(2016)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share