Gene Bio Systems
Recombinant Schizosaccharomyces pombe Copper transport protein ctr5(ctr5)
Recombinant Schizosaccharomyces pombe Copper transport protein ctr5(ctr5)
SKU:CSB-CF865257SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q9P7F9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLSKMSMSGMSGMGMGSSSNSSAATCRMSMLWNWYIHDSCFLAKSWHINTGNKFAGSII GIFFFAVAIEGLSLVQRMFDRWIVAHSNGKTLSGPLRIFFPSSTVHVTVWQQLIRAAMYS SFYLSATILMLIVMSFNGYAILFGFVGAWIGFFLFASDTYGTPSTGTGCCESR
Protein Names:Recommended name: Copper transport protein ctr5 Short name= Copper transporter 5
Gene Names:Name:ctr5 ORF Names:SPAC1142.05
Expression Region:1-173
Sequence Info:full length protein
