Recombinant Schizosaccharomyces pombe ATP synthase subunit J, mitochondrial(atp18)

SKU: CSB-CF517596SXV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O13931

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFGLKRYSTPILKPMLPFFLGGAIVFYGTVKLRDAMMDSAEYRNDPRNPKAGKYGSDH

Protein Names:Recommended name: ATP synthase subunit J, mitochondrial

Gene Names:Name:atp18 ORF Names:SPAC23C4.11

Expression Region:1-60

Sequence Info:full length protein