Gene Bio Systems
Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
Recombinant Schizosaccharomyces japonicus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
SKU:CSB-CF474296SXT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Uniprot NO.:B6K2Z6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKTSPVVPPIKLSEPTESGNDTTETSGRLKHLFRDQPLIPIGCAATVGAFLFATRAIRR GDSMRANRFFRYRVLAQAATVLAIVGGVFMERKMKQEKRMEQITPK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:aim31 ORF Names:SJAG_02975
Expression Region:1-106
Sequence Info:full length protein
