Gene Bio Systems
Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein
Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein
SKU:CSB-CF328381SXQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schistosoma mansoni (Blood fluke)
Uniprot NO.:P23126
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DFSTEIIMIQTINWIVWKLFIIYISLDLFSLKLVNSEENSNSIITDEDYDHYNSSLDSSN NVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSA NKYMKNEFLMSSCIVITLNLFIFMYKS
Protein Names:Recommended name: Antigenic integral membrane glycoprotein Alternative name(s): Antigen Sm25
Gene Names:
Expression Region:36-182
Sequence Info:full length protein
