Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella paratyphi A Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Recombinant Salmonella paratyphi A Sulfoxide reductase heme-binding subunit YedZ(yedZ)

SKU:CSB-CF722114SBM

Regular price €1.487,95 EUR
Regular price Sale price €1.487,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Uniprot NO.:Q5PJV6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLTVKQITWLKVCLHLAGFLPLLWLFWAINHGGLSADPVKDIQHFTGRTALKFLLATLL VSPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTL GIISWLVLLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPIHYLWSVKILSPQPVIYA ALALALLALRYRKFRQWWR

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:SPA3245

Expression Region:1-199

Sequence Info:full length protein

View full details