Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saimiriine herpesvirus 2 Transforming protein STP(1)

Recombinant Saimiriine herpesvirus 2 Transforming protein STP(1)

SKU:CSB-CF322432SAX

Regular price €1.447,95 EUR
Regular price Sale price €1.447,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saimiriine herpesvirus 2 (strain 11) (SaHV-2) (Herpesvirus saimiri)

Uniprot NO.:P18347

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARGLGEGDPQENDESNGDPPHNTDERSDGDDGPTPYLPVTLLNAGPFGPYNPYCLLGHP VQESGCPGRPTALSGAVGLPTPSGSRSSSHLSTPVGLSAVRVSGCGGAGSEEHVYAEVGS LHSEHEQEGDKCTDCSVTILLLLVIIVLLLIIIGLMLVIMFKKM

Protein Names:Recommended name: Transforming protein STP

Gene Names:Name:1 Synonyms:STP

Expression Region:1-164

Sequence Info:full length protein

View full details