Gene Bio Systems
Recombinant Saccharum officinarum Sucrose synthase(SUS1)
Recombinant Saccharum officinarum Sucrose synthase(SUS1)
SKU:CSB-EP335680SVV
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P31925
Gene Names: SUS1
Organism: Saccharum officinarum (Sugarcane)
AA Sequence: ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP
Expression Region: 1-218aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 41.3 kDa
Alternative Name(s): Sucrose-UDP glucosyltransferase
Relevance: Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.
Reference: "Amplification and cloning of sugarcane sucrose synthase cDNA by anchored PCR."Kumar A.S., Moore P.H., Maretzki A.PCR Methods Appl. 2:70-75(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
