Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharum officinarum Photosystem II reaction center protein H(psbH)

Recombinant Saccharum officinarum Photosystem II reaction center protein H(psbH)

SKU:CSB-CF718824SVV

Regular price €1.357,95 EUR
Regular price Sale price €1.357,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharum officinarum (Sugarcane)

Uniprot NO.:Q6ENT5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATQTVEDSSRPKPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIY NSSVLLDGILTN

Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein

Gene Names:Name:psbH

Expression Region:2-73

Sequence Info:full length protein

View full details