Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharopolyspora erythraea UPF0060 membrane protein SACE_5620 (SACE_5620)

Recombinant Saccharopolyspora erythraea UPF0060 membrane protein SACE_5620 (SACE_5620)

SKU:CSB-CF389415STB

Regular price €1.397,95 EUR
Regular price Sale price €1.397,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharopolyspora erythraea (strain NRRL 23338)

Uniprot NO.:A4FL81

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLVILRSVVLFVLAAVAEIGGAWLVWQGVREQRGLLWIGAGVIALGIYGFVATFQPDPNF GRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLIGATICLAGVAVIMYAPR

Protein Names:Recommended name: UPF0060 membrane protein SACE_5620

Gene Names:Ordered Locus Names:SACE_5620

Expression Region:1-110

Sequence Info:full length protein

View full details