Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces pastorianus Protein RER1(RER1)

Recombinant Saccharomyces pastorianus Protein RER1(RER1)

SKU:CSB-CF019567SAJ

Regular price €1.470,95 EUR
Regular price Sale price €1.470,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces pastorianus (Lager yeast) (Saccharomyces carlsbergensis)

Uniprot NO.:P79003

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDYDSPDPMNGASSNALIAKMNSAKLLYQHYLDKVTPHAKQRWAVLGGLLCLFMVRITMA EGWYVICYGLGLFLLNQFLAFLTPKFDMSLQQDEENNELEAGEKSEEFRPFIRRLPEFKF WYNSIRATVISLVLSLFSIFDIPVFWPILLMYFVLLFFLTMRRQIQHMMKYRYIPLDIGK KKYSHPSN

Protein Names:Recommended name: Protein RER1 Alternative name(s): Retention of ER proteins 1

Gene Names:Name:RER1

Expression Region:1-188

Sequence Info:full length protein

View full details