Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae ULP1-interacting protein 3(UIP3)

Recombinant Saccharomyces cerevisiae ULP1-interacting protein 3(UIP3)

SKU:CSB-CF340115SVG

Regular price €1.510,95 EUR
Regular price Sale price €1.510,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P39547

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQTPSENTDVKLDTLDEPSAHLIEENVALPEDTFNSYWSYILNEIARCKPLMIMFLIPVC LVLLITFFHDIKGILVFLVISLILSIIILLIGITAFVSETLNKGFIIKLLVEVITRKPAV GGKEWRIIAYNMNQYLFDHGIWHTPYYFFCEHRCHKFFKSLIKQTRSNAHLSSPTNGAEN TQSNTPAKEVSNEMVKPYIFSSDPVLEAYLIKAAEIHKEAEFEYWRKQYPEVDLP

Protein Names:Recommended name: ULP1-interacting protein 3 Alternative name(s): DUP240 protein UIP3

Gene Names:Name:UIP3 Ordered Locus Names:YAR027W ORF Names:FUN55

Expression Region:1-235

Sequence Info:full length protein

View full details