Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3(SMT3)

Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3(SMT3)

SKU:CSB-EP615489SVG

Regular price €910,95 EUR
Regular price Sale price €910,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: SMT3

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Delivery time: 3-7 business days

Uniprot ID: Q12306

AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-98aa

Protein length: Full Length

MW: 27.1 kDa

Alternative Name(s):

Relevance: Not known; suppressor of MIF2 mutations.

Reference: Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details