Gene Bio Systems
Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)
Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)
SKU:CSB-CF327656SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P37298
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LTIPFLPVLPQKPGGVRGTPNDAYVPPPENKLEGSYHWYMEKIFALSVVPLATTAMLTTG PLSTAADSFFSVMLLGYCYMEFNSCITDYISERVYGVWHKYAMYMLGLGSAVSLFGIYKL ETENDGVVGLVKSLWDSSEKDNSQKIEAKK
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate-ubiquinone reductase membrane anchor subunit
Gene Names:Name:SDH4 Synonyms:ACN18 Ordered Locus Names:YDR178W ORF Names:YD9395.11
Expression Region:32-181
Sequence Info:full length protein
![Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_7f2453d7-82b5-4fac-86c9-1aa84a20b38a.jpg?v=1659245062&width=1445)