Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Stationary phase-expressed protein 1(SPG1)

Recombinant Saccharomyces cerevisiae Stationary phase-expressed protein 1(SPG1)

SKU:CSB-CF463116SVP

Regular price €1.225,95 EUR
Regular price Sale price €1.225,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)

Uniprot NO.:B3LI04

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLDSGIYSEAQRVVRTPKFRYIMLGLVGAAVVPTAYMRRGYTVPAHSLDNINGVDTTKA SVMGTEQRAAMTKGKSLQEMMDDDEVTYLMFSSIM

Protein Names:Recommended name: Stationary phase-expressed protein 1

Gene Names:Name:SPG1 ORF Names:SCRG_00788

Expression Region:1-95

Sequence Info:full length protein

View full details