Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9(IRC9)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9(IRC9)

SKU:CSB-CF344024SVG

Regular price €1.412,95 EUR
Regular price Sale price €1.412,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P47010

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTMQKASKVNMEVRTTLVTMQATTMSIILALPLVVLIASTLVLSVKGRRIHLATSPIILL LLILFKKGQQARSINFTLSKNKSLFCLTFLNYPFHFITAWCHNDILNKYEFCLFLIFLIR IVITINKVTL

Protein Names:Recommended name: Putative uncharacterized protein IRC9 Alternative name(s): Increased recombination centers protein 9

Gene Names:Name:IRC9 Ordered Locus Names:YJL142C ORF Names:J0650

Expression Region:1-130

Sequence Info:full length protein

View full details