Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Protein SLM4(SLM4)

Recombinant Saccharomyces cerevisiae Protein SLM4(SLM4)

SKU:CSB-CF336424SVG

Regular price €1.445,95 EUR
Regular price Sale price €1.445,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P38247

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSI NEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVA QIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG

Protein Names:Recommended name: Protein SLM4 Alternative name(s): EGO complex subunit 3 GSE complex subunit 1

Gene Names:Name:SLM4 Synonyms:EGO3, GSE1 Ordered Locus Names:YBR077C ORF Names:YBR0723

Expression Region:1-162

Sequence Info:full length protein

View full details