Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 2(GET2)

Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 2(GET2)

SKU:CSB-CF409742STA

Regular price €1.570,95 EUR
Regular price Sale price €1.570,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Uniprot NO.:A6ZR39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSELTEAEKRRLLRERRQKKFSNGGASSRLNKITGQASSHLNAESPLDAPSAAKATPPAS VHSATPDIKEDSNVAPQLDLLKQLAAMQGQGTGKSTPQDSSTPDLLSLLSSMNTGMPSAE GTPSFGQAAPAAPINQAALDYHDYLLNRLKAWTILVKWVFFLLPYLYLITRPNSSVWPAY AFTQSAWFAPLRNPSNFTRIFATFEFLSISIYYQLLKNVEHKSKIKNLQDTNKLVKLVSL VPEGVIPVANLKGKLITLLQYWDLLSMLITDISFVLIVLGLLTYL

Protein Names:Recommended name: Golgi to ER traffic protein 2 Alternative name(s): Hydroxyurea resistance protein 2 Required for meiotic nuclear division protein 7

Gene Names:Name:GET2 Synonyms:HUR2, RMD7 ORF Names:SCY_1586

Expression Region:1-285

Sequence Info:full length protein

View full details