Gene Bio Systems
Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 1(GET1)
Recombinant Saccharomyces cerevisiae Golgi to ER traffic protein 1(GET1)
SKU:CSB-CF345268SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P53192
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSIS AQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYG KTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIMEGKFGASKFDDMALQ SVSLGIWVWALMNVINGVEFIVKQLFLTPKMEAPASVETQEEKALDAVDDAIILD
Protein Names:Recommended name: Golgi to ER traffic protein 1 Alternative name(s): Guided entry of tail-anchored proteins 1 Mitochondrial distribution and morphology protein 39
Gene Names:Name:GET1 Synonyms:MDM39 Ordered Locus Names:YGL020C
Expression Region:1-235
Sequence Info:full length protein
