
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)
Uniprot NO.:C7GRJ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AVAGNLLVKRFYQPKLERIPPASLLLKQKIRLAQNGSTTSTENPISFSQTMSEIFSVLQP SAPDLDEDKTSGLKRDHLLTERLNNGELGVIMNKFFNPSSTHNNQLIDTNILLQNFPKLS GNDLDLLDFAINEKMRGNWNDLKQDFIQLWYYKSFGFLGPRTQFVLTNSSPSLRSQFLKL PFTEYNWFLLQNNKNANILPADVQNVVKVFHLDDKRFTWKSIDPFSKAIISFVVFVSIYV WLDESAKQKTKDLPAQKSTVISE
Protein Names:Recommended name: Genetic interactor of prohibitin 7, mitochondrial
Gene Names:Name:GEP7 ORF Names:C1Q_02976
Expression Region:25-287
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial(GEP7)
- Regular price
- €1.133,95 EUR
- Sale price
- €1.133,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial(GEP7)
- Regular price
- €1.133,95 EUR
- Sale price
- €1.133,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial(GEP7)
- Regular price
- €1.133,95 EUR
- Sale price
- €1.133,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial(GEP7)
- Regular price
- €1.146,95 EUR
- Sale price
- €1.146,95 EUR
- Regular price
-
- Unit price
- per
Sold out