Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3(AIM27)

Recombinant Saccharomyces cerevisiae ER membrane protein complex subunit 3(AIM27)

SKU:CSB-CF475327SVH

Regular price €1.528,95 EUR
Regular price Sale price €1.528,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)

Uniprot NO.:B5VLV9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLDDQLKYWVLLPISIVMVLTGVLKQYIMTLITGSSANEAQPRVKLTEWQYLQWAQLLI GNGGNLSSDAFAAKKEFLVKDLTEERHLAKAKQQGGSQAGEVPNPFNDPNMSNAMMNMAK GNMASFIPQTIIMWWVNHFFAGFILMQLPFPLTAKFKEMLQTGIICQDLDVRWVSSISWY FISVLGLNPVYNLIGLNDQDMGIQAGIGGPQGPQGPPQSQVDKAMHAMANDLTIIQHETC LDNVEQRVLKQYM

Protein Names:Recommended name: ER membrane protein complex subunit 3 Alternative name(s): Altered inheritance rate of mitochondria protein 27

Gene Names:Name:AIM27 Synonyms:EMC3 ORF Names:AWRI1631_110210

Expression Region:1-253

Sequence Info:full length protein

View full details