Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae DUP240 protein YAR023C

Recombinant Saccharomyces cerevisiae DUP240 protein YAR023C

SKU:CSB-CF317657SAC

Regular price €1.528,95 EUR
Regular price Sale price €1.528,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (Baker's yeast)

Uniprot NO.:P0CI38

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQPYLKKNTHATDDPKASPLKEGSPDNPESPLISADIVLPEDEFASYQSYLLYEIVRAKY IMINFLLFVVTILATLTDIWFSGVLSPAMVIRICLGGSMVVLQIWSFSRPISNETFRTKL LLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIKGKYPDV QWDTANTQPFISVPENQAATQNSDVEPTVKWCLFKAAEIQAHAVREYWQSQYPDVGIPAI

Protein Names:Recommended name: DUP240 protein YAR023C

Gene Names:

Expression Region:1-240

Sequence Info:full length protein

View full details