Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)

SKU:CSB-CF453390SVP

Regular price €1.430,95 EUR
Regular price Sale price €1.430,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)

Uniprot NO.:B3LLQ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HLSFLMNNNDITPFQKFTVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSNKKSSVKIN EPKKKRILINDPIKITKKLVSDKTFRTIEKNISSLQNTPVIETPCDVHSHLQPRDRIFLL GFFMLSCLWWNLEPQESKPTIDH

Protein Names:Recommended name: Altered inheritance of mitochondria protein 34, mitochondrial

Gene Names:Name:AIM34 ORF Names:SCRG_01898

Expression Region:56-198

Sequence Info:full length protein

View full details