Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 26, mitochondrial(AIM26)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 26, mitochondrial(AIM26)

SKU:CSB-CF335774SVG

Regular price €1.392,95 EUR
Regular price Sale price €1.392,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P32858

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQTMGGEHLLLSQLKGSFFLLLLAYFFRGRSPYYARCYRRLAVTPGAITIAIAIATDSIP ALAKSKVLVSVCSHTDPCTASCNLIPFPRPFSNSLTRFLFCLGSARFCISFPCFGLSI

Protein Names:Recommended name: Altered inheritance of mitochondria protein 26, mitochondrial

Gene Names:Name:AIM26 Ordered Locus Names:YKL037W ORF Names:YKL250

Expression Region:1-118

Sequence Info:full length protein

View full details