Recombinant Rotavirus Non-structural glycoprotein 4, partial

SKU: A9Q1L1

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A9Q1L1

Gene Names: N/A

Alternative Name(s):

Abbreviation: Recombinant Rotavirus Non-structural glycoprotein 4 protein, partial

Organism: Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219))

Source: E.coli

Expression Region: 73-213aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: QTSKIIYIVRLLFWKMYNVINNLVNKMINREKIADRQIVDNRFREFEERFRILLLQHDENIAKQDNIVQYNKLDNFAESIKSEFNLKVAEMERRFQELKWRCDMIANKTMNTIVLTNTVDSTNKDEKIIFDEGSVVQYNRE

MW: 21.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cis-aconitate decarboxylase that catalyzes production of itaconate and is involved in the inhibition of the inflammatory response. Acts as a negative regulator of the Toll-like receptors (TLRs)-mediated inflammatory innate response by stimulating the tumor necrosis factor alpha-induced protein TNFAIP3 expression via reactive oxygen species (ROS) in LPS-tolerized macrophages. Involved in antimicrobial response of innate immune cells; ACOD1-mediated itaconic acid production contributes to the antimicrobial activity of macrophages by generating itaconate, leading to alkylation of proteins, such as TFEB. Involved in antiviral response following infection by flavivirus in neurons: ACOD1-mediated itaconate production inhibits the activity of succinate dehydrogenase, generating a metabolic state in neurons that suppresses replication of viral genomes. Plays a role in the embryo implantation.

Reference: "Myc-dependent endothelial proliferation is controlled by phosphotyrosine 1212 in VEGF receptor-2." Testini C., Smith R.O., Jin Y., Martinsson P., Sun Y., Hedlund M., Sainz-Jaspeado M., Shibuya M., Hellstrom M., Claesson-Welsh L. EMBO Rep 20: e47845-e47845(2019)

Function: