Skip to product information
1 of 1

Gene Bio Systems

Recombinant Roseiflexus sp. Cobalt transport protein CbiM(cbiM)

Recombinant Roseiflexus sp. Cobalt transport protein CbiM(cbiM)

SKU:CSB-CF403860RIQ

Regular price €1.501,95 EUR
Regular price Sale price €1.501,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Roseiflexus sp. (strain RS-1)

Uniprot NO.:A5UQS9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIMEGFLPPVWAGFWFIVVLPFWVLGLRRINRLIAGKPETRLLLGFAAAFAFVLSALKI PSVTGSSSHPTGTGLGTILFGPLVMSVLGSIVLLFQALLIAHGGLTTLGANAFSMAVVGP FVAWLIWKGLKDRAPIWLTVFLAAALADLFTYVVTSAQLALAYPDAVGGFAASFARFGAI FAVTQIPLAISEGILTVLIFNALQANAQTELQSLGVLKGAQA

Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM

Gene Names:Name:cbiM Ordered Locus Names:RoseRS_0560

Expression Region:28-249

Sequence Info:full length protein

View full details