Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia prowazekii Uncharacterized protein RP436 (RP436)

Recombinant Rickettsia prowazekii Uncharacterized protein RP436 (RP436)

SKU:CSB-CF516941RMY

Regular price €1.423,95 EUR
Regular price Sale price €1.423,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia prowazekii (strain Madrid E)

Uniprot NO.:O05963

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQFEAYSLLFVDSFVSNLIISFQNELIFHSMQMLVGYNRLIMLLVAICSSLSGNTVNYL FGKIVLNIFYASKNEQNILRHKNLTKLYYQYETFIIFLISFPFWGCFVSLFSGFFKTKFL KFLSIGCLAKACYYASKIYIF

Protein Names:Recommended name: Uncharacterized protein RP436

Gene Names:Ordered Locus Names:RP436

Expression Region:1-141

Sequence Info:full length protein

View full details