Skip to product information
1 of 1

GeneBio Systems

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

SKU:Q9KKA3

Regular price €847,95 EUR
Regular price Sale price €847,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9KKA3

Gene Names: ompB

Alternative Name(s): (168 kDa surface-layer protein)(Cell surface antigen 5)(Sca5)(Surface protein antigen)(rOmp B)(rOmpB)(120 kDa outer membrane protein OmpB)(Surface protein antigen)(p120)

Abbreviation: Recombinant Rickettsia conorii ompB protein, partial

Organism: Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Source: E.coli

Expression Region: 1335-1655aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-Avi-tagged

Target Protein Sequence: GALRYLGTPETAEMAGPEAGAIPAAVAAGDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVIGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGSAIFSLNQVKNKSQRYFFDANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMAGLSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVTGRLSKTQSVLDGQVTPCISQPDRTAKTSYNLGLSASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF

MW: 43.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: The 120 kDa surface-exposed protein is a major structural protein which may play a role as a rickettsial virulence factor and/or immunogen during infection. ; The 32 kDa beta peptide may serve as a membrane anchor. It has been shown to adhere to biotinylated Vero cell proteins.

Reference:

Function:

View full details