Gene Bio Systems
Recombinant Rhodospirillum centenum UPF0060 membrane protein RC1_3291 (RC1_3291)
Recombinant Rhodospirillum centenum UPF0060 membrane protein RC1_3291 (RC1_3291)
SKU:CSB-CF469491RLY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodospirillum centenum (strain ATCC 51521 / SW)
Uniprot NO.:B6IWH9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATIATYLLAAVAEIGGCFAFWAWLRLDRSPLWLIPGMASLALFAWALTRIDSDLAGRAY AAYGGIYILTSLVWMWLVEGSRPDRWDTLGTVLCVSGALVIIFGPRGGQ
Protein Names:Recommended name: UPF0060 membrane protein RC1_3291
Gene Names:Ordered Locus Names:RC1_3291
Expression Region:1-109
Sequence Info:full length protein
