Gene Bio Systems
Recombinant Rhodopseudomonas palustris UPF0060 membrane protein RPD_3084(RPD_3084)
Recombinant Rhodopseudomonas palustris UPF0060 membrane protein RPD_3084(RPD_3084)
SKU:CSB-CF614429RAAG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodopseudomonas palustris (strain BisB5)
Uniprot NO.:Q135C9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKSPIIYVCAALAEIAGCFAFWGWLRLGKPVWWLLPGMLSLAAFAYLLTLVESQAAGRAY ASYGGIYIVASLVWLWSVENVRPDRWDVTGGCVCLIGAAIILWGPRG
Protein Names:Recommended name: UPF0060 membrane protein RPD_3084
Gene Names:Ordered Locus Names:RPD_3084
Expression Region:1-107
Sequence Info:full length protein
