Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodopirellula baltica UPF0314 protein RB9128(RB9128)

Recombinant Rhodopirellula baltica UPF0314 protein RB9128(RB9128)

SKU:CSB-CF756157RDR

Regular price €1.487,95 EUR
Regular price Sale price €1.487,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodopirellula baltica (strain SH1)

Uniprot NO.:Q7UM18

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNASSSETLEVVDDRFQKDRSWTVAWIAGLIVVGMVLVLAGMGRRFWCECGSWVPWSWDI WTAHNSQHLIDPYFFSHVLHGVLFYWALRWVPRLNRTQCLLIALGLEASWEILENSPLII ERYREATMAVGYTGDSIANSVTDVAACMLGYWFSSRFPWRWSVALFVVSEILMLIMIRDN LLLNVLMLVSPIPAIQEWQSG

Protein Names:Recommended name: UPF0314 protein RB9128

Gene Names:Ordered Locus Names:RB9128

Expression Region:1-201

Sequence Info:full length protein

View full details