Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter sphaeroides UPF0093 membrane protein RHOS4_28450(RHOS4_28450)

Recombinant Rhodobacter sphaeroides UPF0093 membrane protein RHOS4_28450(RHOS4_28450)

SKU:CSB-CF684450RLF

Regular price €1.453,95 EUR
Regular price Sale price €1.453,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q53229

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRMADHFEETTMGTFLADYYLWTKSLHVISVLAWMAGLFYLPRLFVYHAEVVKAGTETDA LFQTMERRLLRAIMNPAMIATWIFGLLLVFTPGIVDWSMLWPWTKAACVLAMTGFHMWLA ARRRDFAAGANRHKGRTYRMMNELPTLLMLVIVFSAVAKWNYWGF

Protein Names:Recommended name: UPF0093 membrane protein RHOS4_28450 Alternative name(s): ORF1

Gene Names:Ordered Locus Names:RHOS4_28450 ORF Names:RSP_1232

Expression Region:1-165

Sequence Info:full length protein

View full details