Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter sphaeroides Reaction center protein L chain(pufL)

Recombinant Rhodobacter sphaeroides Reaction center protein L chain(pufL)

SKU:CSB-CF663108RLF

Regular price €1.565,95 EUR
Regular price Sale price €1.565,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q3J1A5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIAWSAVLQGTWN PQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGIGYHIPFA FAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFF FTNALALALHGALVLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSA VFFSALCMIITGTIWFDQWVDWWQWWVKLPWWANIPGGING

Protein Names:Recommended name: Reaction center protein L chain Alternative name(s): Photosynthetic reaction center L subunit

Gene Names:Name:pufL Ordered Locus Names:RHOS4_18610 ORF Names:RSP_0257

Expression Region:2-282

Sequence Info:full length protein

View full details