Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizopus oryzae ATP synthase subunit 9, mitochondrial(atp9)

Recombinant Rhizopus oryzae ATP synthase subunit 9, mitochondrial(atp9)

SKU:CSB-CF664899RDE

Regular price €1.355,95 EUR
Regular price Sale price €1.355,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizopus oryzae (Rhizopus delemar)

Uniprot NO.:Q3T4E5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVAAAKILGAGLATIGLAGAGVGVGLVFAALINSTSRNPSLRPQLFSYTILGFALTEAIG LFALMMAFLLLYAA

Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein

Gene Names:Name:atp9

Expression Region:1-74

Sequence Info:full length protein

View full details